<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10V, I13A, G16E, K20I, E35D, M36I, R41K, H69K, K70R, L89M  
>02CM.3217MN| codons 1-99
PQITLWQRPVITAKIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11N, K20R, V35T, E36D, K49R, V60I, D121H, I135V, S162A, K173T, Q174K, D177E, T200A, Q207G, R211K, V245Q, E291D, V292I, I293V, P294T, S322T, I326V, G335D, Y342C, R356K, M357K, G359S, A371V, I375V, T403M, V435I, D471E, Q480H, L491S, K512R, S519N, Q520L, Q524E, E529D, V531I, A534S, A554S, I556V  
>02CM.3217MN| codons 1-560
PISPIDTVPVNLKPGMDGPRVKQWPLTEEKIKALTDICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQICQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFKLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNLIIEELIKKDKIYLSWVPAHK
GIGGNEQVDKLVSSGVRKVL

References
Author Title Citation
Carr, JK HIV-1 recombinants with multiple parental strains in low-prevalence, remote regions of Cameroon: Evolutionary relics?. Retrovirology, 2010