<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT+3TC+EFV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, N37D, K45R, R57K, L63T, H69K, L89M  
>BV245-1| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDIDLPGRWKPRMIGGIGGFIKVKQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, T39K, E40Q, K43E, D121H, K122E, D123S, K173A, Q174K, D177E, V179I, I202V, Q207A, R211S  
>BV245-2| codons 23-230
QWPLTEEKIKALTEICKQMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIIIYQYMDDLYVGSDLEIGQHRTKV
EELRAHLLSWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Steegen, K Effectiveness of antiretroviral therapy and development of drug resistance in HIV-1 infected patients in Mombasa, Kenya. AIDS Res Ther, 2009