<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6497 CA16294 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 3TC+D4T+IDV 182
3 3TC+D4T+NFV+NVP 95

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L10F I62V, L63P, A71V, I93L  
>CA16294| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   G190A K101H T39TA, I135T, I142V, S162C, S251SN, K277R, Q278H, D324DE, A360AT, K366KR, T369TA, A371AV, I375IV, A376AST, K390KR, A400T, E404ED, V417VI, T419TI, V435VA, K451KR, D460DN, R461RK, S468SP, T470TA, H483HY, L491LPS, S519SN, Q524QE, A554ST, I556IV, K558KR, V559VI T286AG, A299AG
>CA16031| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDNWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGAKALTEVIPLTEEGE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVRQLAEVVQKVTTESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFINIP
PLVKLWYQLEKEPIAGAETFYVDGAANRETRLGKAGYVTNKGRQKVVPLADTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGVRRIL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005