<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1834 CA16293 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 109
2 D4T+DDI+RTV 19
3 D4T+DDC+NFV+RTV 31
4 D4T+NFV+RTV 10
5 D4T+IDV+NFV+RTV 20
6 D4T+NFV 14
7 3TC+D4T+EFV+NFV 32
8 ABC+APV+D4T 49

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL, L76LV L33F, Q58QE I13V, K43KN, R57K, L63P, A71V, I93L  
>CA16293| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWNPKMIGGIGGFLKVKEYD
QIPIEICGHKVIGTVVVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, L210LW, T215Y       K104N, D123E, I135T, I178M, T200A, Q207EG, R211K, P294Q, E297R, E300R E298R, A299RS
>CA16022| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIQLTRRRR

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005