<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6495 CA16292 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 DDI 26
3 3TC+D4T 39
4 3TC+DDC+IDV 126
5 3TC+DDC+NFV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, K14R, N37D, L63P, A71AV  
>CA16292| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADNTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219Q     K20R, T39A, K82KR, I135V, E169D, Q174N, F214L, L228H, A272P, I293V, T296S, K311R, D324E, G333E, Q334H, R356K, M357I, A360T, T369A, K374R, A376N, E404D, L469I, T470P, D471DE, K476KR, S519N, A554T I309IT
>CA16029| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKNNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLSEEAE
LELAENRETLREPVHGVYYDPSKELIAEIQKQEHGQWTYQIYQEPFKNLKTGKYAKIRGT
HTNDVKQLAEAVQRINTESIVIWGKTPKFKLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSIPETTNQRTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001