<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75VI K103N, V106M   T39E, S48T, V60I, K122E, D123N, I132L, Q174K, T200E, Q207E, F214L, V245Q  
>GT7052005| codons 38-247
CEEMEKEGKITKIGPENPYNTPIFAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSMTVLDVGDAYFSVPLDENFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIVIYQYVDDLYVGSDLEIGQHREKIEELREHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Orrell, C HIV type-1 clade C resistance genotypes in treatment-naive patients and after first virological failure in a large community antiretroviral therapy programme. Antivir Ther, 2009