<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, E40D, K49KR, S68G, K104R, I135R, S162A, K173I, Q174K, D177E, T200A, Q207E, R211RG, F214L, V245Q  
>04TE04| codons 38-247
CADMEKEGKISRIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKRSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLGWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Lawrence, P Analysis of polymorphism in the protease and reverse transcriptase genes of HIV type 1 CRF02-AG subtypes from drug-naive patients from Saint-Etienne, France. JAIDS, 2006