<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA801 CA16254 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 52
2 3TC+D4T+RTV 13
3 3TC+D4T+IDV 54
4 D4T+DDI+RTV+SQV 24
5 3TC+AZT+NFV 21
6 DDI+EFV+Unknown 11
7 3TC+AZT+IDV+NVP+RTV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L10LF, G73GS I15IV, K20X, M36I, K55KR, R57K, I62V, L63P, A71V, I85IV  
>CA16254| codons 1-99
PQITLWQRPFVTIKVGGQLXEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVRVKQYD
QVPIEICGHKVISTVLVGPTPANIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69AD, M184MV, L210W, T215Y V75VA, K219KE K103N V108VI V35I, E40X, K43KE, V118I, D123E, I135T, S162CY, Q207E, H208X, R211K, L228H, Q242QP, T286A, I293V, E297K  
>CA15992| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTXLEEEGKISKIGPENPYNTPV
FAIKKKNSAKWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREXLWKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VPPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005