<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4450 CA16232 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 261
2 3TC+AZT+IDV 19
3 D4T+DDI+NFV+NVP 21
4 3TC+D4T+DDI+NFV+NVP 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46ML L33LF I62V, L63A  
>CA16232| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVFEEMNLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V D67G, K70R_N, K219Q     K11R, K20R, V35I, K49R, K64N, D123DN, I135T, T165I, D177E, I195L, F214L, D218E, V245T, K277R, Q278H, A288S, I293V, P294PT, E297K S68Y
>CA15970| codons 1-299
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISRIGPENPYNTPV
FAINKKGYTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIVI
YQYVDDLYVGSDLELGQHRTKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGTKSLTEVVTLTKEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005