<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV+NVP 13
2 None 69
3 3TC+ABC+AZT+NFV+NVP 9
4 None 91
5 3TC+AZT+LPV 48
6 3TC+ATV+DDI+RTV+TDF 61
7 DDI+APV+RTV+TDF 61
8 None 57
9 3TC+ABC+ATV+DDC+RTV+TDF 19
10 DDI+RAL+TDF+3TC+ABC 25
11 DDI+RAL+TDF+ETR 98

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, L74LV   K103N, Y181C, M230L F227C K20R, V35I, K122E, T200A, R211K, V245Q, I293V, E297A  
>CA162236| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPCLWLGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, I62V, L63P, I64L, I72V  
>CA162235| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPLEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H G163K E10D, I72V, L101I, I113V, S119P, T122I, T124N, T125A, V201I P142T
>CA162234| codons 1-288
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTVHTDNGPN
FISNAVKAACWWAGIKQEFGITYNPQSQGVVESMHKELKKIIKQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012