<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GCC_10BL GCC_10BL Spain 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H V151I A21S, M22I, A23V, S24G, I84V, M154I, V165I, V201I, D232N  
>GCC_10BL| codons 1-288
FLDGIDKAQEEHEKYHSNWRSIVGDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYVEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESIHKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Blanco, JL HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis, 2011