<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JRM_04BL JRM_04BL Spain 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
G140S, Q148H   K14R, V32I, S39C, L101I, T112I, I135V, V201I, T206S, T218S, I220V, K240R, C280S D286N
>JRM_04BL| codons 2-288
LDGIDKAQEEHERYHSNWRAMASDFNLPPVIAKEIVACCDKCQLKGEAMHGQVDCSPGIW
QLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSNF
TSTTVKAACWWAGVKQEFSIPYNPQSHGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVF
IHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQISKVQNFRVYYRDSRDPLWKGPARL
LWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDSVASRQNED

References
Author Title Citation
Blanco, JL HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis, 2011