<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4519 CA16206 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+AZT+IDV NA
3 3TC+AZT 60
4 3TC+D4T+NFV 104
5 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M F53FL, N88D L10V, I15V, K20KR, E34ED, E35ED, M36I, N37D, K45KR, L63P, A71T, I72V Q92S
>CA16206| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADNTVLDDIDLPGRWKPRMIGGIGGLIKVRQYD
QIPIEICGHKTVGTVLVGPTPVNIIGRDLMTSIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       V35VI, T39A, S68G, K122KE, Q174R, Q207R, R211K, S251I, V292I, I293V, E297A  
>CA15944| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRRHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDIWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTAEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005