<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2083 CA16204 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 104
2 AZT+ 3TC+ SQV 17
3 AZT+ 3TC+ IDV 24
4 DDI+ D4T+ IDV 35
5 3TC+ D4T+ NVP 23
6 DLV+ SQV+ NFV 29
7 DLV+ D4T+ IDV 16
8 DDI+ 3TC+ D4T 11
9 DDI+ 3TC+ D4T+ RTV+ SQV 16
10 DDI+ 3TC+ D4T+ APV+ SQV+ ADV 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73C L10I, K20I, I54X, D60E, L63PQ, I64V, V77I, I85V, I93IL  
>CA16204| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFXKVRQYE
QIPVEICGHKAICTVLIGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K103N, Y181C   K43N, E44D, S48E, V118I, K122P, K166R, D177E, G196E, R211K, D218E, V245E, A272P, K277R, L283LI, I293V, E297R, V317A, D324E, Q334L, G359S, T369V, A371V, I375V, A376S, T377M, K390R, S468P, H483Y  
>CA15935| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKIEKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPEKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTREAE
LELAENREILKEPVHGAYYDPSKELIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLVEVVQKVSMESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009