<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4565 CA16203 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+D4T+SQV 80
3 D4T+DDI+NFV 60
4 D4T+EFV+SQV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, E35D, M36I, I62V, L63P, I64V, T74S  
>CA16203| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGSVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI K219Q G190E   K20R, S48T, T69S, K122E, I135T, Q197E, F214L, V245K P157A, I159IL, D185DG
>CA37766| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKNSSRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSAALFQSSMTKILEPFRKQNPDIVI
YQYMGDLYVESDLEIGEHRTKIEELRQHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEK

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005