<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM04_097 CM04_097 Cameroon 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K20R, M36I, R57K, D60E, I62L, L63P, H69Q  
>CM04_097| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYE
QLPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, S48T, K122P, D123E, A158S, S162A, Q174K, D177E, Q207E, P243T, V245Q, E248D, D250S, N255K  
>CM04_097| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRKKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPDKSSWTVKDIQKLV

References
Author Title Citation
Soares, EA Molecular diversity and polymerase gene genotypes of HIV-1 among treatment-naive Cameroonian subjects with advanced disease. J Clin Virol, 2010