<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM04_095 CM04_095 Cameroon 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16A, E35N, M36I, N37D, R41K, R57K, D60E, H69K, L89M  
>CM04_095| codons 1-99
PQITLWQRPLVTVKIAGQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVKQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35M, T39S, S68G, D121Y, K122E, I135T, T139M, S162C, E169D, K173A, Q174K, D177E, V179I, G196E, Q207A, R211S, V245Q  
>CM04_095| codons 1-262
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALMEICSEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPEIII
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVG

References
Author Title Citation
Soares, EA Molecular diversity and polymerase gene genotypes of HIV-1 among treatment-naive Cameroonian subjects with advanced disease. J Clin Virol, 2010