<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM04_089 CM04_089 Cameroon 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K20I, L33V, E35N, M36I, N37D, R41K, L63P, G68E, H69R, V77I, L89M  
>CM04_089| codons 1-99
PQITLWQRPVVTVKIGGQLIEALLDTGADDTVVENIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICERKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219Q     K11T, V35T, T39K, K64R, D121Y, K122E, T139A, I142V, E169D, K173T, Q174K, D177E, I178M, G196E, T200A, Q207A, R211S  
>CM04_089| codons 1-236
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNEAPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRTKNPEMVI
YQYMDDLYVGSDLEIEQHRAKIEELRAHLLSWGFTTPDQKHQKEPPFLWMGYELHP

References
Author Title Citation
Soares, EA Molecular diversity and polymerase gene genotypes of HIV-1 among treatment-naive Cameroonian subjects with advanced disease. J Clin Virol, 2010