<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM04_094 CM04_094 Cameroon 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, K20R, E35D, M36I, R41K, K45R, L63A, H69K, L89M  
>CM04_094| codons 1-99
PQITLWQRPVVTVRIEGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I2V, K11T, V35T, T39G, K43E, S68G, D121H, K122E, D123S, I135T, E138A, S162H, K173S, Q174K, G196E, T200A, Q207A, R211K, V245Q, E248D  
>CM04_094| codons 1-259
PVSPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICGEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRSKNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQK

References
Author Title Citation
Soares, EA Molecular diversity and polymerase gene genotypes of HIV-1 among treatment-naive Cameroonian subjects with advanced disease. J Clin Virol, 2010