<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20M, E35D, M36I, R41K, R57K, Q61N, L63Q, E65D, I93L Q7P
>53| codons 1-99
PQITLWPRPLVTIKVGGQLMEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NIQIDICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, E40D, K122E, Q207E, R211K, D250E, A272P, K281R, I293V, P294Q, E297R  
>53| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVQLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Espinosa, A Intersubtype BF recombinants of HIV-1 in a population of injecting drug users in Argentina. JAIDS, 2004