<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1 1 Argentina 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15A, K20M, E35D, M36I, R41K, R57K, Q61D, L63P, I93L  
>1| codons 1-99
PQITLWQRPLVTIKAGGQLMEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
DIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  Q151QL     V35T, T39L, A98S, E138A, A158AT, K166R, Q197E, R211K, A272P, K275R, K277R, E291D, E297K T128S, V148VM, K154I, P157L, I159IM
>1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYSAFTIPSINNATPGIRYQYNMLPLGWIGSLTMFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTDVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Espinosa, A Intersubtype BF recombinants of HIV-1 in a population of injecting drug users in Argentina. JAIDS, 2004