<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6403 CA16166 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 65
2 3TC+D4T+RTV 56
3 3TC+AZT+NFV 98

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, G73S Q7QH, R8X, L10V, T12K, G16A, R41K, K43R, L63P, A71V  
>CA16166| codons 2-99
QITLWQXPVVKIKIAGQLKEALLDTGADDTVFEEMNLPGKWRPKLIGGIGGFVKVRQYDQ
IPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215SY K219E     M41X, K122E, D123N, I135T, N175H, I178M, Q197E, I202V, V245M, A272P, K277GR, A288S, I293V, E297A  
>CA15904| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEXEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQHPDMVI
YQYVDDLYVGSDLEIGEHRTKVEELRQHLLRWGFSTPDEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVGQLCKLLRGTKSLTEVVPLTAEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001