<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, Q151M A62AV, V75I, F77L, F116Y, K219E K101E, Y181C, G190A   I135IT, S162SHNR, V245M, T286A, I293V, E297A, I326V, Q334E, A360T, V365I, E370A, V381I  
>120750| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKNSTRWRKLIDLRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQRSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDIKQLTAAVQKIATESIIIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82VA L24LI, Q58QE I62IV, L63PS, I64IV, V77I, I93IL  
>120750| codons 1-99
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYD
QVSVEICGHKAIGTVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004