<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7D, K14KR, I15V, G17GE, E35D, M36I, R41K, R57RK, D60DE, Q61N, I62V, L63S  
>119381| codons 1-99
PQITLWDRPLVTIRVGEQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
NVSIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, D123DE, I135V, R211K, A272P, K281R, T286A, E297K, K311R, V317VA, Q334H, K366R, A371V, I375V, A376T, T377L, E399D  
>119381| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTKEAE
LELAENREILREPVHGAYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLTEVVQKVTLESIVIWGKTPKFKLPIQKETWD

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004