<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W T215C K103N   K20R, V35L, K43E, V90I, D121Y, K122E, I135V, S162A, D177E, R211K, A272P, K277R, T286A, E297T, Q332P, G333E, Q334H, R356K, M357V, K366R E396A
>118749| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKPEHGQWTYQIYQEPFKNLKTGKYAKVRGA
HTNDVRQLTEAVQKIATESIVIWGKTPKFKLPIQKATWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A F53L, L89V L10I, L19I, A71V  
>118749| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTILEEMNLPGRWKPKIIGGIGGLVKVRQYD
QILIEICGHKVIGTVLVGPTPANIIGRNVLTQIGCTLNF

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004