<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1811 CA16126 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 60
2 D4T 20
3 3TC+ SQV 13
4 3TC+ SQV+ RTV 2
5 AZT+ 3TC+ IDV 130
6 D4T+ EFV+ RTV+ SQV 75

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I84V   L10I, A22V, N37T, R57K, I62IV, L63P, A71V, I72V, V77I, I93L  
>CA16126| codons 1-99
PQITLWQRPIVTIKIGGQLKEVLLDTGADDTVLEEMTLPGRWKPKIIVGIGGFIKVKQYD
QVPIEICGHKVVGTVLIGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   Y188L K238T I135M, S162Y, R211K, V245Q, K277R  
>CA15893| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLC

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005