<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5205 CA16120 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+IDV 45
2 D4T+IDV+NVP 77
3 ABC+AZT+NFV 19
4 ABC+DDC+NFV 8
5 ABC+DDI+RTV+SQV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L10I, I13V, K20I, L63P, I64V, I93L  
>CA16120| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y   K101KE, Y181C, G190A   K20R, T139X, T165TI, V179VI, T200TA, R211K, K275Q, K277R, T286A, E291D, I293IV K281KQ, R284RM, K287KN
>CA15859| codons 1-298
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEXPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIII
CQYMDDLYVASDLEIGQHRAKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVRQLCQLLMGANALTDVVPLTEE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005