<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1144 CA16107 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 57
3 AZT+DDI 8
4 AZT+DDC 35
5 3TC+D4T 13
6 AZT+D4T+RTV+SQV 57
7 AZT+D4T+RTV+SQV 31
8 3TC+D4T+NFV 17
9 3TC+D4T+NFV+NVP 52
10 3TC+D4T+NFV+NVP 26
11 3TC+D4T+IDV+RTV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, L90M Q58E L10V, K14R, F53Y, Q61E, I62V, L63P, A71V, T74S, V77I, I93L  
>CA16107| codons 1-99
PQITLWQRPVVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGYVKVREYD
EVPIEICGHKVIGSVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q G190GA   V35M, T69N, V118I, K122E, I135T, S162SG, V179VI, I202V, F214L, D237DE, A272P, K277R  
>CA15846| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRKQNPDIII
YQYVDDLYVASDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003