<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1449 CA16101 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 55
2 ABC+ADV+EFV 23
3 ADV+EFV+NFV 21
4 EFV+IDV+NFV 4
5 3TC+IDV+SQV 49

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90LM N88D I15V, E35D, M36V, N37E, I62V, L63P  
>CA16101| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDVELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y A62AV     K20R, I31IL, T39TA, K43KN, L74X, K122E, R211K, A272AP N265NS, K275KN
>CA15838| codons 1-277
PISPIETVPVKLKPGMDGPRVKQWPLTEEKLKALVEICAELENEGKISKIGPENPYNTPV
FVIKKKDSTKWRKXVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLSWASQIYPGINVK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005