<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4035 CA16100 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 28
2 AZT+DDI 14
3 3TC+AZT 9
4 3TC+AZT+RTV 35
5 3TC+D4T 49
6 3TC+D4T+NFV 42
7 Unknown 49
8 ABC+D4T+DDI 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, E35D, M36V, N37Y, R41K, I62V, L63P, V77I, I93L  
>CA16100| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDVYLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N, G190A   K20R, A98S, K101R, K122E, I135T, I142T, K173Q, Q174K, D177E, T200A, Q207E, R211K, A288S, I293V, E297R E138EV, T296TP
>CA15837| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLRKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNVTPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLPREAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005