<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
102600 102600 Argentina 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y N348I K103N   V35IR, A98S, I135T, Q174H, G196E, R211K, V245M, E248D, A272P, K277R, T286P, E297R, I326V, Q334D, R356K, K366R, A376T, T386TA, K390R, A400AT  
>102600| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGPKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGDGQWTYQIYQEPFKILKTGKYAKMRGA
HTNDVRQLTEAVQKITTESIVIWGKAPKFRLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D T12TA, I13V, Q18QH, L19I, N37S, I64V, A71V, V77I  
>102600| codons 1-99
PQITLWQRPLVAVKIGGHIKEALLDTGADNTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004