<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1548 CA16085 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 AZT+ DDC 108
3 DDI 95
4 D4T 30
5 3TC+ AZT 39
6 3TC+ AZT+ IDV 21
7 3TC+ D4T+ IDV 12
8 3TC+ D4T+ NFV+ NVP 21
9 3TC+ D4T+ NFV+ SQV 39
10 D4T+DDI+NFV+SQV 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, K43T, F53L L10I, E35D, M36I, I62V, L63P, I64V, G73V, T74S  
>CA16085| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEDINLPGRWTPKIIGGIGGLVKVRQYD
QVPVEICGHKAIVSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219E     K11KR, K20R, V60I, V118I, D123E, S162Y, I178M, V179I, T200A, E203D, D218E, L228H, Q242H, I293V, A304G  
>CA15798| codons 1-304
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDMII
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLRWGFYTPEEKHQKEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELG

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005