<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       V35M, A98S, D123E, I135V, S162C, I178L, E203K, Q207E, R211K, A272P, K277R, K281R, T286A, E291D, I293V, E297K, V317A, S322T, Q334D, A360T, E370EG, I375V, I382V  
>98908| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRTKIKELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGAKALTDVVPLTKEAE
LELAENREILKEPVHGAYYDPTKDLIAEIQKQGDGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTGAVQKVATESIVVWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D N37E, R41K, D60E, I62V, L63P, V77I, I93L  
>98908| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEEMELPGKWKPKMIGGIGGFIKVRQYE
QVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004