<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
96217 96217 Argentina 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82AG   L10I, T12TP, T31TP, N37D, K43KN, L63P, H69Q, A71V, T74S, V77I, I93L T26TP
>96217| codons 1-99
PQITLWQRPIVPIKIGGQLKEALLDPGADDPVLEEMDLPGRWNPKIIGGIGGFVKVRQYD
QIPIEICGQKVIGSVVIGPTPGNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, M184I, L210W, T215Y K219R Y181C A98G K20R, K101Q, V118I, K122P, I135T, I178M, Q197K, D218E, T240TP, V245E, S251I, K277R, L283I, I293V, P294Q, E312ED, D320DA, S322A, R356K, G359S, K366R, T377TP, T386I, K390R, A400T L12L*, Q23QH, T351TP
>96217| codons 1-400
PISPIETVPVK*KPGMDGPRVKHWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLQKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
CQYIDDLYVGSDLEIGKHRTKIEELRQHLWRWGFYTPERKHQKEPPFLWMGYELHPDKWP
VQPIELPEKDIWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLIRGTKALTEVVQLTEEAE
LELAENREILKDPVHGVYYAPAKDLIAEIQKQGQGQWTYQIYQEPFKNLKPGKYAKMRSA
HTNDVRQLTEAVQKIAPESIVIWGKIPKFRLPIQKETWET

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004