<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
94580 94580 Argentina 2002 HIV1 CRF12_BF Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   Q7QH, L10I, T12TP, E35D, M36I, R41K, R57K, Q61N, L63P, A71AT T26TP
>94580| codons 1-99
PQITLWHRPIVPIKIGGQLKEALLDPGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
NIPIEICGHKTIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67NT, K70R, T215F K219Q, N348I Y181C   V21VG, V35T, K49KR, K101Q, K122E, I135V, S162C, N175H, T200A, L210LV, T240TP, D250E, L260LV, A272P, K281R, E291D, E297K, Q334DY, I393M, Q394L, E399D, A400T V10VG, T139KN, Y318YD, A360AG, F389FV
>94580| codons 1-400
PISPIETVPGKLKPGMDGPKGKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKTSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNENPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQHPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLVRWGFFTPDQKHQKEPPFLWMGYELHPDKWP
VQPIVLPEKESWTVNDIQKVVGKLNWASQIYPGIKVKQLCRLLRGTKALTDVIPLTKEAE
LELAENREILKEPVHGVDYDPSKDLIAEIQKQGYGQWTYQIYQEPFKILKTGKYARMRGG
HTNDVKQLTEAVQKIATESIVIWGKTPKVKLPMLKETWDT

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004