<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
93641 93641 Argentina 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S Q7QH, L10V, I13V, K14N, N37A, K43KN, L63P, A71V, I72L, V77I  
>93641| codons 1-99
PQITLWHRPVVTVNIGGQLKEALLDTGADDTVLEEMALPGRWNPKIIGGIGGFIKVRQYD
QIPIEICGHKVLSTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   L100I, G190A A98G I31IL, V35I, K43E, E44D, K49R, V118I, I135T, Q207K, H208Y, R211D, H221Y, L228R, V245E, T290TP, E297K, L325I, R356K, A376S, T377L, K395R, E399D, A400T A304P, T351TP, K366KN, K390K*
>93641| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALIEICTELEEDGKISRIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGIKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRKYLWDWGFYTPDKKYQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALPEVIPLTKEAE
LELPENREILKEPVHGVYYDPSKDIIAEIQKQGQGQWTYQIYQEPFKNLKPGKYAKMRGA
HTNDVNQLTEAVQKISLESIVIWGKTPKF*LPIQRETWDT

References
Author Title Citation
Gomez-Carrillo, M Drug resistance testing provides evidence of the globalization of HIV type 1: A new circulating recombinant form. ARHR, 2004