<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6494 CA16026 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 AZT+DDC 43
3 3TC+AZT+IDV 100
4 3TC+AZT+NFV 56
5 APV+D4T+DDI+NVP 9
6 APV+D4T+DDI 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DN, K70R, L74LI, T215F K219Q Y181C   K20R, S48T, K102KR, K122E, I135T, S162Y, T200A, L228H, K277R, I293V, P294A, E297K  
>CA16026| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVALTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M K43T L10I, D60E, L63P, K70KR, A71V, I93IL  
>CA16289| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMNLPGRWTPKIIGGIGGFIKVRQYE
QIPIEICGHRVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009