<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6483 CA16011 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 69
2 D4T+DDI+NVP 39
3 D4T+DDI+NFV 21
4 DDC+RTV+SQV 48
5 ABC+APV+EFV+RTV 46

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y V75M, K219KN L100I, K103N   V60I, V118I, I135T, K173E, R211K, H221Y, D250E, Q278H, I293V, P294A  
>CA16011| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDNKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVALTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84V, L90M L33F, N88D L10V, I13V, E34K, R41K, D60DE, L63P, V77I  
>CA16273| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVFKEMNLPGKWKPKLIGGIGGFLKVRQYE
QIPIEICGHKAIGTVLIGPTPVNVIGRDLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001