<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2314 CA16001 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 30
2 AZT+DDI 52
3 AZT+D4T 8
4 3TC+RTV 26
5 3TC+IDV+RTV+SQV 30
6 3TC+D4T+NFV+NVP 69
7 3TC+DDI+SQV 26
8 3TC+D4T 12
9 3TC+DDI+IDV+RTV 17
10 APV+AZT+D4T+DDI 26
11 3TC+ABC+APV+IDV+RTV 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N K103N, Y181C V108I, F227L K20R, K43N, E44ED, K101KR, V118I, K122E, I135T, G196E, T200TA, E203K, H208HY, R211K, K223E, L228H, I293V, A304G  
>CA16001| codons 1-304
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLRKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRAKIKELRQYLWKWGFYTPDNKHQEEPPLHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, Q58E, G73C L10I, I13V, K14KR, L19LI, E35D, M36L, N37D, R57K, I62V, L63P, T74S  
>CA16264| codons 1-99
PQITLWQRPIVTVRIGGQIKEALLDTGADDTVFEDLDLPGRWKPKMIGGIGGFVKVKEYD
QVPIEICGHKAICSVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005