<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6462 CA15979 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 104
2 3TC+AZT 26
3 3TC+D4T 197

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q, N348NI     K101R, K102Q, K122KE, D123DN, I135L, I142IT, K166R, Q207H, R211K, L228LH, A272P, K275R, Q278H, T286A, I293IL, E300EG, V317VA, Q334P, P345A, G359S, V365VI, K366R, A371V, A376V, A400T, T403S, L452LS, D460N, S468T, H483Y, L491S, K512R, S519N, V531I, K550R, A554T, K558R D471DA
>CA15979| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRQKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTEVLPLTEEAG
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGPGQWTYQIYQEAFKILKTGKYARMRSA
HTNDIRQLTEVVQKIVTESIVIWGKTPKFKLPIQKETWETWWSEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKSGKAGYVTNRGRQKVVTLTATTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDRLVSTGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, I62V, L63P, V77I, I93L  
>CA16241| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009