<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6455 CA15972 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC 134
2 ABC+DDI+EFV 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, M184V   K103N L234LI K101R, K102Q, I135V, I142V, S162A, Q174H, R211K, H221HY, V245E  
>CA15972| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLRQNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKYQKEPPFLWMGYEIHPDKWT
VQPIELPEKDSWTVNDIQK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41RK, L63T, I72V, V77I  
>CA16234| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009