<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1127 CA15951 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 DDI 4
3 AZT+DDC 52
4 3TC+AZT 56
5 3TC+D4T+SQV 22
6 3TC+D4T+IDV 26
7 3TC+D4T+RTV+SQV 115
8 3TC+D4T+IDV+SQV 17
9 3TC+D4T+IDV 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215FV K219Q     K20R, T69N, K102R, K122P, I135V, D177E, V179I, G196E, F214L, V245T, A272P, Q278H, T286A, I293IV, E297A  
>CA15951| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALTEVVPLTAEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, K20R, E35ED, M36I, N37D, R41K, I62IV, L63PS, I64L, A71V, I93L  
>CA16213| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIVGIGGFTKVRQYD
QVPLEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005