<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6437 CA15949 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 108
2 3TC+AZT+SQV 34
3 DDC+DLV+NFV 130

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, L210W T215H, K219N K101E, Y181C   K43N, E44D, V118I, D123E, D177E, E203D, Q207E, H208Y, R211K, A272P, I293V A299AG
>CA15949| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIDELREYLWKWGFHTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73ST L10I, L24F, N37C, K45R, K55R, R57K, L63P, A71V, V77I, I93L  
>CA16211| codons 1-99
PQITLWQRPIVTIKIGGQLKEALFDTGADDTVLEEMCLPGRWKPRIIGGIGGFIRVKQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009