<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6434 CA15945 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 52
2 NRTI 108
3 NFV+ DDI+ D4T 113

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75I, F77L, F116Y     K20R, K32E, V35I, K49R, I135V, S162CW, E169D, Q207E, R211K, A272P, I293V  
>CA15945| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIEALIEICTEMEKEGKISRIGPENPYNTPV
FVIKKKDSTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10X, I13IV, K14R, K20T, E35D, M36I, R41K, I62V, L63P, A71IT, T74S, Q92R, I93L  
>CA16207| codons 1-99
PQITLWQRPXVTVRIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKIIGSVLVGPTPVNIIGRNLLTRLGCTLNF

References
Author Title Citation
Gonzales, MJ Colinearity of reverse transcriptase inhibitor resistance mutations detected by population-based sequencing. JAIDS, 2003
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005