<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6423 CA15929 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 74
2 D4T+NFV+NVP 57
3 ABC+AZT+EFV+RTV+SQV 60

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74V, T215F   K103N, Y181C, G190A   P1L, I31L, V35L, K122E, D123N, R211K, L228H, T286A K281KE
>CA15929| codons 1-303
LISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFFTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELLRGAKALTEVIPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, I54V F53L, N88D L10I, I13V, K20R, E35D, M36I, L63P, A71T, I93L  
>CA16197| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADNTVLEDINLPGRWKPKIIGGIGGLVKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009