<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6414 CA15918 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 D4T 87
3 3TC+D4T+IDV 44
4 D4T+DDI+NFV 39
5 RTV+SQV 48
6 ABC+EFV+RTV+SQV 77

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, L210LW T215C, K219E L100I, K103N K238KT K122E, D123E, I135V, K166R, I178M, K223E, L228LR, E233EK, L246LP, K277R  
>CA15918| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFCTPDEKHQEEPPFRWMGYKLHPDTWT
VQPIVPPEKDSWTVNDIQKLVGKLNWASQIYAGIKVR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I64V, V77I  
>CA16180| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005