<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, I15V, K20T, E35G, M36I, N37S, R57K, Q61N, L63P, I64V, T74S, V82I, I93L  
>PHAC_219| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEGISLPGRWKPKMIGGIGGFIKVKQYD
NIPVEICGHKAIGSVLVGPTPINIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       T69S, D123E, I135V, S162C, T200A, E203D, R211K, A272P, V276I, Q278E, T286A  
>PHAC_219| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIDELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKELCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPV

References
Author Title Citation
Ragonnet-Cronin, M Longitudinal phylogenetic surveillance identifies distinct patterns of cluster dynamics. JAIDS, 2010
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012
Ragonnet-Cronin, M Genetic diversity as a marker for timing infection in HIV-infected patients: Evaluation of a 6-month window and comparison with BED. J Infect Dis, 2012