<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHAC_219 PHAC_219 Canada 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, I15V, K20T, E35G, M36I, N37S, R57K, Q61N, L63P, I64V, T74S, V82I, I93L  
>PHAC_219| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEGISLPGRWKPKMIGGIGGFIKVKQYD
NIPVEICGHKAIGSVLVGPTPINIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       T69S, D123E, I135V, S162C, T200A, E203D, R211K, A272P, V276I, Q278E, T286A  
>PHAC_219| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIDELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKELCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPV

References
Author Title Citation
Ragonnet-Cronin, M Longitudinal phylogenetic surveillance identifies distinct patterns of cluster dynamics. JAIDS, 2010
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012
Ragonnet-Cronin, M Genetic diversity as a marker for timing infection in HIV-infected patients: Evaluation of a 6-month window and comparison with BED. J Infect Dis, 2012