<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6409 CA15910 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 92
2 None 96
3 D4T+NFV+NVP 96
4 ABC+APV 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K101E, Y181YC E138EK K20R, T39A, T69N, K122E, A158AT, I202V, L228LR, V245IM, R284K, A288T, I293V  
>CA15910| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPTIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFFTPDQKHQKEPPFRWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKTLTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L33LF, G73S L10I, K20T, E35D, M36I, N37E, I62V, L63P, A71V  
>CA16172| codons 10-99
IVTIKIGGQLTEALLDTGADDTVFEDIELPGRWKPKMIGGIGGFIKVRQYDQVPIEICGH
KVISTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009