<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6406 CA15907 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 48
2 3TC+AZT 34
3 3TC+DDI 5
4 3TC+DDI+RTV 16
5 D4T+DDC+NFV 18
6 D4T+DDC+NVP 27
7 3TC+D4T+DDI+NFV+NVP 15
8 3TC+AZT+NFV+NVP 42
9 3TC+D4T+EFV+RTV+SQV 3
10 3TC+D4T+RTV+SQV 10
11 3TC+D4T+IDV+NFV 38

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, M184V, L210W, T215Y V75VA, K219E K101E, Y181C, G190A A98AG P4S, V35L, E44D, L109LI, V118I, K122E, I135IV, G196E, D218E, L228H, S251I, A272AP, A288ST, I293V A299AG
>CA15907| codons 1-303
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKIADFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVIDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIEQHRTKIEELRQHLWRWGFYTPEEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDIWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTEEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82A, L90M K43T L10I, I62V, L63P, I64V, V77I  
>CA16169| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIVGIGGFAKVRQYD
QVPVEICGHKAIGTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005