<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1811 CA15893 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 60
2 D4T 20
3 3TC+ SQV 13
4 3TC+ SQV+ RTV 2
5 AZT+ 3TC+ IDV 130
6 D4T+ EFV+ RTV+ SQV 75

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   Y188L K238T I135M, S162Y, R211K, V245Q, K277R  
>CA15893| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLC

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I84V   L10I, A22V, N37T, R57K, I62IV, L63P, A71V, I72V, V77I, I93L  
>CA16126| codons 1-99
PQITLWQRPIVTIKIGGQLKEVLLDTGADDTVLEEMTLPGRWKPKIIVGIGGFIKVKQYD
QVPIEICGHKVVGTVLIGPTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005